Gria1 Peptide - N-terminal region
Gria1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
2900051M01Rik, AI853806, Glr-1, Glr1, GluR-A, GluRA, Glur-1, Glur1, HIPA1, GluA1, gluR-K1
UniProt
P23818
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Gria1 Rabbit Polyclonal Antibody (orb576373) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001106796
Preservative
Lyophilized powder
AA Sequence
CGALHVCFITPSFPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details