Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grik5 Peptide - N-terminal region

Grik5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GluRgamma2, KA2, MGC118086

UniProt

Q80WU3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Grik5 Rabbit Polyclonal Antibody (orb575364) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032194

Preservative

Lyophilized powder

AA Sequence

LTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-ALS2CR8/CARF Polyclonal Antibody
PAV4839 100 μL

Rabbit Anti-ALS2CR8/CARF Polyclonal Antibody

Sign In for Pricing
View Details
TRNAG32P Protein Lysate (Human) with C-Ha Tag
48058031 100 µg

TRNAG32P Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Cas12 (LbCpf1)
orb1742856-01 50 µg

Cas12 (LbCpf1)

Sign In for Pricing
View Details
Cas12 (LbCpf1)
orb1742856-02 100 µg

Cas12 (LbCpf1)

Sign In for Pricing
View Details
Recombinant Microplitis demolitor bracovirus Uncharacterized protein G2 (G2)
MBS1355167-01 0.02 mg (E-Coli)

Recombinant Microplitis demolitor bracovirus Uncharacterized protein G2 (G2)

Sign In for Pricing
View Details
Recombinant Microplitis demolitor bracovirus Uncharacterized protein G2 (G2)
MBS1355167-02 0.1 mg (E-Coli)

Recombinant Microplitis demolitor bracovirus Uncharacterized protein G2 (G2)

Sign In for Pricing
View Details