Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grik5 Peptide - N-terminal region

Grik5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GluRgamma2, KA2, MGC118086

UniProt

Q80WU3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Grik5 Rabbit Polyclonal Antibody (orb575364) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032194

Preservative

Lyophilized powder

AA Sequence

LTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 1- (3-cyanopropyl) -1H-1,2,3-triazole-4-carboxylate
YGC03321-01 50 mg

Methyl 1- (3-cyanopropyl) -1H-1,2,3-triazole-4-carboxylate

Sign In for Pricing
View Details
Methyl 1- (3-cyanopropyl) -1H-1,2,3-triazole-4-carboxylate
YGC03321-02 0.5 g

Methyl 1- (3-cyanopropyl) -1H-1,2,3-triazole-4-carboxylate

Sign In for Pricing
View Details
CF097, CT (CCDC170, C6orf97, Coiled-coil domain-containing protein 170) (APC)
033801-APC 200 µL

CF097, CT (CCDC170, C6orf97, Coiled-coil domain-containing protein 170) (APC)

Sign In for Pricing
View Details
Mouse 1700016K19Rik (NM_198637) AAV Particle
MR202730A1V 250 µL

Mouse 1700016K19Rik (NM_198637) AAV Particle

Sign In for Pricing
View Details
KIR2.3 (KCNJ4) (NM_004981) Human Untagged Clone
SC123960 10 µg

KIR2.3 (KCNJ4) (NM_004981) Human Untagged Clone

Sign In for Pricing
View Details
FUCA2 Rabbit pAb (APR18941N)
APR18941N-01 50 µL

FUCA2 Rabbit pAb (APR18941N)

Sign In for Pricing
View Details