Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRINL1A Peptide - C-terminal region

GRINL1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp586F1918, GCOM1, Gdown, Gdown1, GRINL1A

UniProt

P0CAP2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRINL1A Rabbit Polyclonal Antibody (orb326416) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056347

Preservative

Lyophilized powder

AA Sequence

QHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urolithin C
TRC-U847015-25MG 25 mg

Urolithin C

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF568 conjugate, 0.1mg/mL
BNC680955-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PATL2 activation kit by CRISPRa
GA116294 1 Kit

Human PATL2 activation kit by CRISPRa

Sign In for Pricing
View Details
Cadm4 Mouse Gene Knockout Kit (CRISPR)
KN502446 1 Kit

Cadm4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Caspase-7 (CASP7) Rabbit Monoclonal Antibody
TA422746 100 µL

Caspase-7 (CASP7) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS626290 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details