Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRINL1A Peptide - C-terminal region

GRINL1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp586F1918, GCOM1, Gdown, Gdown1, GRINL1A

UniProt

P0CAP2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRINL1A Rabbit Polyclonal Antibody (orb326416) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056347

Preservative

Lyophilized powder

AA Sequence

QHLDDITAARLLPLHHMPTQLLSIEESLALQKQQKQNYEEMQAKLAAQKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10-Undecylenic Aldehyde
TRC-U788835-50G 50 g

10-Undecylenic Aldehyde

Sign In for Pricing
View Details
Acid Phosphatase (ACP1) Sheep Polyclonal Antibody
AP05058PU-N 100 µg

Acid Phosphatase (ACP1) Sheep Polyclonal Antibody

Sign In for Pricing
View Details
GK5 Rabbit Polyclonal Antibody
TA370119 100 µL

GK5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRPL9 Antibody
8C14089-AAT 50 µg

MRPL9 Antibody

Sign In for Pricing
View Details
P5CS (ALDH18A1) (NM_002860) Human Over-expression Lysate
LY419053 100 µg

P5CS (ALDH18A1) (NM_002860) Human Over-expression Lysate

Sign In for Pricing
View Details
9530002B09Rik Mouse Gene Knockout Kit (CRISPR)
KN500524 1 Kit

9530002B09Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details