Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRK1 Peptide - middle region

GRK1 Peptide - middle region

Product Specifications

Product Name Alternative

GPRK1, RHOK, RK

UniProt

Q15835

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRK1 Rabbit Polyclonal Antibody (orb584451) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002920

Preservative

Lyophilized powder

AA Sequence

NKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSX2 (NM_002449) Human Over-expression Lysate
LC400874 20 µg

MSX2 (NM_002449) Human Over-expression Lysate

Sign In for Pricing
View Details
Vmn2r50 Mouse Gene Knockout Kit (CRISPR)
KN519180 1 Kit

Vmn2r50 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse KIM-1 Protein (Halo Tag)
PDMM100247-01 20 µg

Recombinant Mouse KIM-1 Protein (Halo Tag)

Sign In for Pricing
View Details
Recombinant Mouse KIM-1 Protein (Halo Tag)
PDMM100247-02 100 µg

Recombinant Mouse KIM-1 Protein (Halo Tag)

Sign In for Pricing
View Details
Recombinant Mouse KIM-1 Protein (Halo Tag)
PDMM100247-03 500 µg

Recombinant Mouse KIM-1 Protein (Halo Tag)

Sign In for Pricing
View Details
Recombinant Mouse KIM-1 Protein (Halo Tag)
PDMM100247-04 1 mg

Recombinant Mouse KIM-1 Protein (Halo Tag)

Sign In for Pricing
View Details