Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRLF1 Peptide - N-terminal region

GRLF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARHGAP35, GRF-1, KIAA1722, MGC10745, P190-A, P190A, p190ARhoGAP, p190RhoGAP, GRLF1

UniProt

B2RTN5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRLF1 Rabbit Polyclonal Antibody (orb324574) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077318

Preservative

Lyophilized powder

AA Sequence

RPSADEFHLDHTSVLSTSDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOV10 Polyclonal Antibody
E-AB-68364-01 60 µL

MOV10 Polyclonal Antibody

Sign In for Pricing
View Details
MOV10 Polyclonal Antibody
E-AB-68364-02 120 µL

MOV10 Polyclonal Antibody

Sign In for Pricing
View Details
MOV10 Polyclonal Antibody
E-AB-68364-03 200 µL

MOV10 Polyclonal Antibody

Sign In for Pricing
View Details
2-Octyldodecane-1-ol
TRC-O241150-50G 50 g

2-Octyldodecane-1-ol

Sign In for Pricing
View Details
N-Oxo Samidorphan
TRC-O311980-50MG 50 mg

N-Oxo Samidorphan

Sign In for Pricing
View Details
Slc50a1 Mouse Gene Knockout Kit (CRISPR)
KN316149RB 1 Kit

Slc50a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details