Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRM7 Peptide - C-terminal region

GRM7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ40498, GLUR7, GPRC1G, MGLU7, MGLUR7

UniProt

Q14831

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRM7 Rabbit Polyclonal Antibody (orb331055) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000835

Preservative

Lyophilized powder

AA Sequence

HPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRXR1/TXNRD1 Protein, Human, Recombinant (aa 161-647, His Tag)
MBS8121268-01 0.1 mg

TRXR1/TXNRD1 Protein, Human, Recombinant (aa 161-647, His Tag)

Sign In for Pricing
View Details
TRXR1/TXNRD1 Protein, Human, Recombinant (aa 161-647, His Tag)
MBS8121268-02 5x 0.1 mg

TRXR1/TXNRD1 Protein, Human, Recombinant (aa 161-647, His Tag)

Sign In for Pricing
View Details
Recombinant Human HEXIM1 Protein, N-His-SUMO & C-Strep
YHB51101 100 μg

Recombinant Human HEXIM1 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r2 shRNA (UAS) - Lentiviral mouse Vmn1r2 shRNA (UAS, RFP) (100)
GTR15116412 1 Vial

Lentiviral mouse Vmn1r2 shRNA (UAS) - Lentiviral mouse Vmn1r2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Microscope Lamp on Stand
4022300 1 Each

Microscope Lamp on Stand

Sign In for Pricing
View Details
Lentiviral human MAP7 shRNA (UAS) - Lentiviral human MAP7 shRNA (UAS, RFP) (25)
GTR15329534 1 Vial

Lentiviral human MAP7 shRNA (UAS) - Lentiviral human MAP7 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details