Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTA3 Peptide - middle region

GSTA3 Peptide - middle region

Product Specifications

Product Name Alternative

GSTA3-3, GTA3, MGC22232

UniProt

Q16772

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSTA3 Rabbit Polyclonal Antibody (orb330559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000838

Preservative

Lyophilized powder

AA Sequence

SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dactimicin sulfate
T23952L-01 100 mg

Dactimicin sulfate

Sign In for Pricing
View Details
Dactimicin sulfate
T23952L-02 25 mg

Dactimicin sulfate

Sign In for Pricing
View Details
Dactimicin sulfate
T23952L-03 50 mg

Dactimicin sulfate

Sign In for Pricing
View Details
Phospho-AQP2 (Ser264) Rabbit Polyclonal Antibody
orb4532-01 50 μL

Phospho-AQP2 (Ser264) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-AQP2 (Ser264) Rabbit Polyclonal Antibody
orb4532-02 100 µL

Phospho-AQP2 (Ser264) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-AQP2 (Ser264) Rabbit Polyclonal Antibody
orb4532-03 200 µL

Phospho-AQP2 (Ser264) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details