Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTA3 Peptide - middle region

GSTA3 Peptide - middle region

Product Specifications

Product Name Alternative

GSTA3-3, GTA3, MGC22232

UniProt

Q16772

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSTA3 Rabbit Polyclonal Antibody (orb330559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000838

Preservative

Lyophilized powder

AA Sequence

SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1598 3'UTR GFP Stable Cell Line
TU061720 1.0 mL

KIAA1598 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Wnk4 shRNA (UAS) - Lentiviral mouse Wnk4 shRNA (UAS) (25)
GTR15159029 1 Vial

Lentiviral mouse Wnk4 shRNA (UAS) - Lentiviral mouse Wnk4 shRNA (UAS) (25)

Sign In for Pricing
View Details
Mouse Hcrtr2 Pre-designed siRNA Set B
SI106090B 1 Each

Mouse Hcrtr2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r1 shRNA (UAS) - Lentiviral mouse Vmn1r1 shRNA (UAS, RFP) plasmid
GTR15161929 1 Vial

Lentiviral mouse Vmn1r1 shRNA (UAS) - Lentiviral mouse Vmn1r1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Candida albicans (PE) discontinued
C1075-01C-PE 100 µL

Candida albicans (PE) discontinued

Sign In for Pricing
View Details
FRG1 (NM_004477) Human Over-expression Lysate
LS002483 100 µg

FRG1 (NM_004477) Human Over-expression Lysate

Sign In for Pricing
View Details