Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTA4 Peptide - N-terminal region

GSTA4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686D21185, GSTA4-4, GTA4

UniProt

O15217

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSTA4 Rabbit Polyclonal Antibody (orb580443) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001503

Preservative

Lyophilized powder

AA Sequence

LAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pzp shRNA (UAS) - Lentiviral mouse Pzp shRNA (UAS) (100)
GTR15208230 1 Vial

Lentiviral mouse Pzp shRNA (UAS) - Lentiviral mouse Pzp shRNA (UAS) (100)

Sign In for Pricing
View Details
WDR85 Protein Lysate (Human) with C-Ha Tag
50378031 100 µg

WDR85 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Fruit fly Mvl Rabbit Polyclonal Antibody (Cy3)
orb3002597 200 µL

Fruit fly Mvl Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Lgals2 Mouse shRNA Lentiviral Particle (Locus ID 107753)
TL513514V 500 µL Each

Lgals2 Mouse shRNA Lentiviral Particle (Locus ID 107753)

Sign In for Pricing
View Details
ADH4 (NM_000670) Human Over-expression Lysate
LS000127 100 µg

ADH4 (NM_000670) Human Over-expression Lysate

Sign In for Pricing
View Details
Porcine Prostaglandin E2 (PGE2) ELISA Kit
NSL1208Po 96 Tests

Porcine Prostaglandin E2 (PGE2) ELISA Kit

Sign In for Pricing
View Details