Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTA4 Peptide - N-terminal region

GSTA4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686D21185, GSTA4-4, GTA4

UniProt

O15217

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSTA4 Rabbit Polyclonal Antibody (orb580443) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001503

Preservative

Lyophilized powder

AA Sequence

LAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HYAL1 (NM_153283) Human Tagged Lenti ORF Clone
RC216187L4 10 µg

HYAL1 (NM_153283) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CMTM6 (NM_017801) Human Untagged Clone
SC113956 10 µg

CMTM6 (NM_017801) Human Untagged Clone

Sign In for Pricing
View Details
Beta-lactoglobulin Rabbit Polyclonal Antibody (PE-Cy5)
orb891691 100 µL

Beta-lactoglobulin Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
TRIM66 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
47836111 3x 1.0 µg

TRIM66 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
QTRT1 Protein Vector (Mouse) (pPM-C-HA)
38280024 500 ng

QTRT1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Human MAP1LC3A activation kit by CRISPRa
GA113597 1 Kit

Human MAP1LC3A activation kit by CRISPRa

Sign In for Pricing
View Details