GSTK1 Peptide - middle region
GSTK1 Peptide - middle region
Product Specifications
Product Name Alternative
GST13, GST, hGSTK1, GSTK1-1, GST13-13, GST 13-13
UniProt
Q9Y2Q3
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GSTK1 Rabbit Polyclonal Antibody (orb582718) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057001
Preservative
Lyophilized powder
AA Sequence
NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HA723289H 100 µL
Human Mesothelin Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
TAF-462-1 1 mL
Texas Red Conjugated Goat Affinity Purified Antibody to Rat IgG (min.x Hu., Bov., Eq.)
Sign In for Pricing
View Details