Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTK1 Peptide - middle region

GSTK1 Peptide - middle region

Product Specifications

Product Name Alternative

GST13, GST, hGSTK1, GSTK1-1, GST13-13, GST 13-13

UniProt

Q9Y2Q3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSTK1 Rabbit Polyclonal Antibody (orb582718) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057001

Preservative

Lyophilized powder

AA Sequence

NLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL33 Rabbit Polyclonal Antibody
AP08936PU-N 50 µg

IL33 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GFAP Mouse Monoclonal Antibody [Clone ID: GA-8]
AM20624PU-N 100 µg

GFAP Mouse Monoclonal Antibody [Clone ID: GA-8]

Sign In for Pricing
View Details
Phosphoserine Aminotransferase (PSAT1) Human qPCR Primer Pair (NM_058179)
HP231983 200 Reactions

Phosphoserine Aminotransferase (PSAT1) Human qPCR Primer Pair (NM_058179)

Sign In for Pricing
View Details
o-Cymene
TRC-C994100-500MG 500 mg

o-Cymene

Sign In for Pricing
View Details
Ssu72 (BC016544) Mouse Tagged ORF Clone
MG201644 10 µg

Ssu72 (BC016544) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
C5orf13 Antibody
8C17005-AAT 50 µg

C5orf13 Antibody

Sign In for Pricing
View Details