Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM1 Peptide - C-terminal region

GSTM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GST1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GTM1, H-B, MGC26563, MU, MU-1

UniProt

P09488

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GSTM1 Rabbit Polyclonal Antibody (orb578208) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_666533

Preservative

Lyophilized powder

AA Sequence

PEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C4orf33 activation kit by CRISPRa
GA115174 1 Kit

Human C4orf33 activation kit by CRISPRa

Sign In for Pricing
View Details
KLH Rabbit Polyclonal Antibody
AP09215PU-N 1 mg

KLH Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UPP2 (C-term) Rabbit Polyclonal Antibody
AP54478PU-N 400 µL

UPP2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BHLHB9 Rabbit Polyclonal Antibody
ER1802-8 100 µL

BHLHB9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ANXA5 Polyclonal Antibody
D-AB-10212L-01 25 µL

ANXA5 Polyclonal Antibody

Sign In for Pricing
View Details
ANXA5 Polyclonal Antibody
D-AB-10212L-02 100 µL

ANXA5 Polyclonal Antibody

Sign In for Pricing
View Details