Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2A1 Peptide - C-terminal region

GTF2A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC129969, MGC129970, TF2A1, TFIIA

UniProt

P52655

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GTF2A1 Rabbit Polyclonal Antibody (orb573763) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_963889

Preservative

Lyophilized powder

AA Sequence

QAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Sdr16c6 shRNA (UAS) - Lentiviral mouse Sdr16c6 shRNA (UAS) plasmid
GTR15207583 1 Vial

Lentiviral mouse Sdr16c6 shRNA (UAS) - Lentiviral mouse Sdr16c6 shRNA (UAS) plasmid

Sign In for Pricing
View Details
EREG (Proepiregulin, Epiregulin, EPR) (Biotin)
126438-Biotin 100 µL

EREG (Proepiregulin, Epiregulin, EPR) (Biotin)

Sign In for Pricing
View Details
DDX39A Rabbit pAb (APR30117N)
APR30117N-01 50 µL

DDX39A Rabbit pAb (APR30117N)

Sign In for Pricing
View Details
DDX39A Rabbit pAb (APR30117N)
APR30117N-02 100 µL

DDX39A Rabbit pAb (APR30117N)

Sign In for Pricing
View Details
DDX39A Rabbit pAb (APR30117N)
APR30117N-03 200 µL

DDX39A Rabbit pAb (APR30117N)

Sign In for Pricing
View Details
2-Bromopropionic acid
FB53769-01 2000 g

2-Bromopropionic acid

Sign In for Pricing
View Details