Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2A1 Peptide - C-terminal region

GTF2A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC129969, MGC129970, TF2A1, TFIIA

UniProt

P52655

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GTF2A1 Rabbit Polyclonal Antibody (orb573763) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_963889

Preservative

Lyophilized powder

AA Sequence

QAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDCD3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV638817 1.0 µg DNA

NUDCD3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Metadherin Rabbit mAb
E38A4137 100 µg -100 µL

Metadherin Rabbit mAb

Sign In for Pricing
View Details
Tm2d1 (NM_053157) Mouse Tagged ORF Clone
MR202221 10 µg

Tm2d1 (NM_053157) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MLKL Rabbit pAb
E2380559 100 µL

MLKL Rabbit pAb

Sign In for Pricing
View Details
Kainic acid
MBS3614070 Inquire

Kainic acid

Sign In for Pricing
View Details
Rabbit Polyclonal Scn2b Antibody [Alexa Fluor 405]
NBP3-00206AF405 0.1 mL

Rabbit Polyclonal Scn2b Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details