Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2A1 Peptide - middle region

GTF2A1 Peptide - middle region

Product Specifications

Product Name Alternative

MGC129969, MGC129970, TF2A1, TFIIA

UniProt

P52655

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GTF2A1 Rabbit Polyclonal Antibody (orb583894) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_963889

Preservative

Lyophilized powder

AA Sequence

GQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APPL (APPL1) Human Knockdown Lysate
LY300046 100 µg

APPL (APPL1) Human Knockdown Lysate

Sign In for Pricing
View Details
Bcl-2 (100/D5), Biotin conjugate, 0.1mg/mL
BNCB0045-100 1x 100 µL

Bcl-2 (100/D5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Befunolol
TRC-B131100-25MG 25 mg

Befunolol

Sign In for Pricing
View Details
NPPC (NM_024409) Human Recombinant Protein
TP761624 50 µg

NPPC (NM_024409) Human Recombinant Protein

Sign In for Pricing
View Details
TIMP3 (Center) Rabbit Polyclonal Antibody
AP54257PU-N 400 µL

TIMP3 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DIABLO Polyclonal Antibody
E-AB-14352-01 20 µL

DIABLO Polyclonal Antibody

Sign In for Pricing
View Details