Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2A1 Peptide - middle region

GTF2A1 Peptide - middle region

Product Specifications

Product Name Alternative

MGC129969, MGC129970, TF2A1, TFIIA

UniProt

P52655

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GTF2A1 Rabbit Polyclonal Antibody (orb583894) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_963889

Preservative

Lyophilized powder

AA Sequence

GQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (T-Cell Marker) (C3e/2479), CF640R conjugate, 0.1mg/mL
BNC402479-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2479), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CEP43 Antibody
KC-17978-01 50 μL

CEP43 Antibody

Sign In for Pricing
View Details
CEP43 Antibody
KC-17978-02 100 µL

CEP43 Antibody

Sign In for Pricing
View Details
CEP43 Antibody
KC-17978-03 1 mL

CEP43 Antibody

Sign In for Pricing
View Details
TRM11 (TRMT11) (NM_001031712) Human Over-expression Lysate
LY422163 100 µg

TRM11 (TRMT11) (NM_001031712) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD21 Antibody[HI21a]
E-AB-F1320M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD21 Antibody[HI21a]

Sign In for Pricing
View Details