Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2A1L Peptide - C-terminal region

GTF2A1L Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALF, MGC26254

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GTF2A1L Rabbit Polyclonal Antibody (orb582252) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_751946

Preservative

Lyophilized powder

AA Sequence

EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C7orf26 siRNA (Human)
orb1855990-01 15 nmol

C7orf26 siRNA (Human)

Sign In for Pricing
View Details
C7orf26 siRNA (Human)
orb1855990-02 30 nmol

C7orf26 siRNA (Human)

Sign In for Pricing
View Details
RNase A for biochemistry
1341GR150 150 g

RNase A for biochemistry

Sign In for Pricing
View Details
Zfp414 ORF Vector (Mouse) (pORF)
50963014 1.0 µg DNA

Zfp414 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
TUSC4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2561806 1.0 µg DNA

TUSC4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human IFNA6 Protein
E30P1642 20 µg

Recombinant Human IFNA6 Protein

Sign In for Pricing
View Details