Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2A1L Peptide - C-terminal region

GTF2A1L Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALF, MGC26254

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GTF2A1L Rabbit Polyclonal Antibody (orb582252) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_751946

Preservative

Lyophilized powder

AA Sequence

EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ifna13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
24249114 3x 1.0 µg

Ifna13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
KDM4C Polyclonal Antibody
E-AB-13351-01 20 µL

KDM4C Polyclonal Antibody

Sign In for Pricing
View Details
KDM4C Polyclonal Antibody
E-AB-13351-02 60 µL

KDM4C Polyclonal Antibody

Sign In for Pricing
View Details
KDM4C Polyclonal Antibody
E-AB-13351-03 120 µL

KDM4C Polyclonal Antibody

Sign In for Pricing
View Details
KDM4C Polyclonal Antibody
E-AB-13351-04 200 µL

KDM4C Polyclonal Antibody

Sign In for Pricing
View Details
Kcnk13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6963107 1.0 µg DNA

Kcnk13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details