Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gtf2h3 Peptide - N-terminal region

Gtf2h3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

34kDa, 5033417D07Rik, BTF2, C730029A10, D5Ertd679e, TFIIH, BTF2 p34

UniProt

Q8VD76

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gtf2h3 Rabbit Polyclonal Antibody (orb576351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852075

Preservative

Lyophilized powder

AA Sequence

YPGKNGGLGDFFGDPGNALPDCNPSGSKDGKYELLTVANEVIAEEIKDLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin L (CTSL) (NM_001912) Human Over-expression Lysate
LC400711 20 µg

Cathepsin L (CTSL) (NM_001912) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Phenylamino Adenosine
TRC-P319530-50MG 50 mg

2-Phenylamino Adenosine

Sign In for Pricing
View Details
PDE6C Antibody
KC-26520-01 50 μL

PDE6C Antibody

Sign In for Pricing
View Details
PDE6C Antibody
KC-26520-02 100 µL

PDE6C Antibody

Sign In for Pricing
View Details
PDE6C Antibody
KC-26520-03 1 mL

PDE6C Antibody

Sign In for Pricing
View Details
Ethyl 3-Furoate
TRC-E918300-25G 25 g

Ethyl 3-Furoate

Sign In for Pricing
View Details