Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gtf2h3 Peptide - N-terminal region

Gtf2h3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

34kDa, 5033417D07Rik, BTF2, C730029A10, D5Ertd679e, TFIIH, BTF2 p34

UniProt

Q8VD76

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gtf2h3 Rabbit Polyclonal Antibody (orb576351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852075

Preservative

Lyophilized powder

AA Sequence

YPGKNGGLGDFFGDPGNALPDCNPSGSKDGKYELLTVANEVIAEEIKDLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBXA2R Polyclonal Antibody
E-AB-67989-01 60 µL

TBXA2R Polyclonal Antibody

Sign In for Pricing
View Details
TBXA2R Polyclonal Antibody
E-AB-67989-02 120 µL

TBXA2R Polyclonal Antibody

Sign In for Pricing
View Details
TBXA2R Polyclonal Antibody
E-AB-67989-03 200 µL

TBXA2R Polyclonal Antibody

Sign In for Pricing
View Details
TMLHE (N-term) Rabbit Polyclonal Antibody
AP54290PU-N 400 µL

TMLHE (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), CF405S conjugate, 0.1mg/mL
BNC043247-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFNA2 Antibody (HRP)
KH-646-01 50 μL

IFNA2 Antibody (HRP)

Sign In for Pricing
View Details