Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guf1 Peptide - C-terminal region

Guf1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4631409J12, AA407526, EF-4

UniProt

Q8C3X4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Guf1 Rabbit Polyclonal Antibody (orb583616) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766299

Preservative

Lyophilized powder

AA Sequence

YLFPLNEIVVDFYDSLKSLSSGYASFDYEDAGYQTAELVKMDILLNGNMV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS29 (NM_016226) Human Recombinant Protein
TP319311L 1 mg

VPS29 (NM_016226) Human Recombinant Protein

Sign In for Pricing
View Details
Human VCIP 135 (VCPIP1) activation kit by CRISPRa
GA112823 1 Kit

Human VCIP 135 (VCPIP1) activation kit by CRISPRa

Sign In for Pricing
View Details
Descyano Cimetidine Dihydrochloride Salt
TRC-D290645-25MG 25 mg

Descyano Cimetidine Dihydrochloride Salt

Sign In for Pricing
View Details
Calcineurin A / PPP3CA (CALNA/2353), CF594 conjugate, 0.1mg/mL
BNC942353-100 1x 100 µL

Calcineurin A / PPP3CA (CALNA/2353), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
H2BC5 Human Gene Knockout Kit (CRISPR)
KN401189 1 Kit

H2BC5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF488A conjugate, 0.1mg/mL
BNC881025-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details