Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guf1 Peptide - C-terminal region

Guf1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4631409J12, AA407526, EF-4

UniProt

Q8C3X4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Guf1 Rabbit Polyclonal Antibody (orb583616) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766299

Preservative

Lyophilized powder

AA Sequence

YLFPLNEIVVDFYDSLKSLSSGYASFDYEDAGYQTAELVKMDILLNGNMV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTMT2 Human qPCR Primer Pair (NM_001136107)
HP232961 200 Reactions

NTMT2 Human qPCR Primer Pair (NM_001136107)

Sign In for Pricing
View Details
Cellulose Sulfate Gel (Technical Grade)
TRC-C256500-10G 10 g

Cellulose Sulfate Gel (Technical Grade)

Sign In for Pricing
View Details
Human USP53 activation kit by CRISPRa
GA110159 1 Kit

Human USP53 activation kit by CRISPRa

Sign In for Pricing
View Details
C4orf44 (MSANTD1) Human Gene Knockout Kit (CRISPR)
KN424127 1 Kit

C4orf44 (MSANTD1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human TNFR1/TNFRSF1A Protein (Fc Tag)
PKSH033160-01 10 µg

Recombinant Human TNFR1/TNFRSF1A Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human TNFR1/TNFRSF1A Protein (Fc Tag)
PKSH033160-02 50 µg

Recombinant Human TNFR1/TNFRSF1A Protein (Fc Tag)

Sign In for Pricing
View Details