Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guk1 Peptide - N-terminal region

Guk1 Peptide - N-terminal region

Product Specifications

UniProt

E9PTV0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Guk1 Rabbit Polyclonal Antibody (orb582298) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013133

Preservative

Lyophilized powder

AA Sequence

RPVVLSGPSGAGKSTLLKKLFQEHGSVFGFSVSHTTRNPRPGEEDGKDYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

StAR Recombinant Antibody, Cy5.5 Conjugated
bsm-63220R-Cy5.5 100 µL

StAR Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
5-Hydroxy Flunixin-d3 (Major)
436664-01 1 mg

5-Hydroxy Flunixin-d3 (Major)

Sign In for Pricing
View Details
5-Hydroxy Flunixin-d3 (Major)
436664-02 10 mg

5-Hydroxy Flunixin-d3 (Major)

Sign In for Pricing
View Details
Lta (NM_010735) Mouse Tagged ORF Clone Lentiviral Particle
MR226758L4V 200 µL

Lta (NM_010735) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Csf1r 3'UTR Luciferase Stable Cell Line
TU202847 1.0 mL

Csf1r 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
BMPR1A (NM_004329) Human Tagged ORF Clone Lentiviral Particle
RC206048L1V 200 µL

BMPR1A (NM_004329) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details