Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guk1 Peptide - N-terminal region

Guk1 Peptide - N-terminal region

Product Specifications

UniProt

E9PTV0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Guk1 Rabbit Polyclonal Antibody (orb582298) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013133

Preservative

Lyophilized powder

AA Sequence

RPVVLSGPSGAGKSTLLKKLFQEHGSVFGFSVSHTTRNPRPGEEDGKDYY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOCS6 siRNA (Mouse)
MBS8237720-01 15 nmol

SOCS6 siRNA (Mouse)

Sign In for Pricing
View Details
SOCS6 siRNA (Mouse)
MBS8237720-02 30 nmol

SOCS6 siRNA (Mouse)

Sign In for Pricing
View Details
SOCS6 siRNA (Mouse)
MBS8237720-03 5x 30 nmol

SOCS6 siRNA (Mouse)

Sign In for Pricing
View Details
Canine Cystatin 9 like (CST9L) ELISA Kit
GTR10349798 96 Well

Canine Cystatin 9 like (CST9L) ELISA Kit

Sign In for Pricing
View Details
MDMX (A-11)
sc-374147 200 µg/mL

MDMX (A-11)

Sign In for Pricing
View Details
BMP 5 Recombinant Protein
32-1084-20 20 µg

BMP 5 Recombinant Protein

Sign In for Pricing
View Details