Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GZMA Peptide - C-terminal region

GZMA Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTLA3, HFSP

UniProt

P12544

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GZMA Rabbit Polyclonal Antibody (orb582484) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006135

Preservative

Lyophilized powder

AA Sequence

LRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 820 Anti-human CD305 Antibody *NKTA255*
130500P1-AAT 500 Tests

IFluor® 820 Anti-human CD305 Antibody *NKTA255*

Sign In for Pricing
View Details
5- (2,5-Dimethyl-4- (prop-1-en-1-yl) phenoxy) -2,2-dimethylpentanoic acid
OR1058064-01 100 mg

5- (2,5-Dimethyl-4- (prop-1-en-1-yl) phenoxy) -2,2-dimethylpentanoic acid

Sign In for Pricing
View Details
5- (2,5-Dimethyl-4- (prop-1-en-1-yl) phenoxy) -2,2-dimethylpentanoic acid
OR1058064-02 250 mg

5- (2,5-Dimethyl-4- (prop-1-en-1-yl) phenoxy) -2,2-dimethylpentanoic acid

Sign In for Pricing
View Details
5- (2,5-Dimethyl-4- (prop-1-en-1-yl) phenoxy) -2,2-dimethylpentanoic acid
OR1058064-03 1 g

5- (2,5-Dimethyl-4- (prop-1-en-1-yl) phenoxy) -2,2-dimethylpentanoic acid

Sign In for Pricing
View Details
PITX1 (Paired-like Homeodomain 1, BFT, POTX, PTX1)
250139 100 µg

PITX1 (Paired-like Homeodomain 1, BFT, POTX, PTX1)

Sign In for Pricing
View Details
Recombinant E. coli RNA Pyrophosphohydrolase/rppH
32-8693-50 50 µg

Recombinant E. coli RNA Pyrophosphohydrolase/rppH

Sign In for Pricing
View Details