Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Harbi1 Peptide - N-terminal region

Harbi1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D230010M03Rik, RP23-12H6.3

UniProt

Q8BR93

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Harbi1 Rabbit Polyclonal Antibody (orb326029) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848839

Preservative

Lyophilized powder

AA Sequence

ITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYFLVELLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin expression factor 2 (MYEF2) Rabbit Polyclonal Antibody
TA366420 100 µL

Myelin expression factor 2 (MYEF2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl 2-Bromoisovalerate
TRC-E900330-5G 5 g

Ethyl 2-Bromoisovalerate

Sign In for Pricing
View Details
Human Tubulin Beta 3 (TUBb3) ELISA Kit
RDR-TUBb3-Hu-01 96 Tests

Human Tubulin Beta 3 (TUBb3) ELISA Kit

Sign In for Pricing
View Details
Human Tubulin Beta 3 (TUBb3) ELISA Kit
RDR-TUBb3-Hu-02 48 Tests

Human Tubulin Beta 3 (TUBb3) ELISA Kit

Sign In for Pricing
View Details
SCCPDH Polyclonal Antibody
E-AB-19034-01 20 µL

SCCPDH Polyclonal Antibody

Sign In for Pricing
View Details
SCCPDH Polyclonal Antibody
E-AB-19034-02 60 µL

SCCPDH Polyclonal Antibody

Sign In for Pricing
View Details