Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Harbi1 Peptide - N-terminal region

Harbi1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D230010M03Rik, RP23-12H6.3

UniProt

Q8BR93

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Harbi1 Rabbit Polyclonal Antibody (orb326029) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848839

Preservative

Lyophilized powder

AA Sequence

ITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYFLVELLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgA Immunoglobulin (IA761), CF405S conjugate, 0.1mg/mL
BNC040761-100 1x 100 µL

Human IgA Immunoglobulin (IA761), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LENEP Human Gene Knockout Kit (CRISPR)
KN417784 1 Kit

LENEP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TVP23A (NM_001079512) Human Over-expression Lysate
LY421505 100 µg

TVP23A (NM_001079512) Human Over-expression Lysate

Sign In for Pricing
View Details
trans-Piceatannol
TRC-P436300-1MG 1 mg

trans-Piceatannol

Sign In for Pricing
View Details
Als2cl Mouse Gene Knockout Kit (CRISPR)
KN501170 1 Kit

Als2cl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HLA-DR (MHC II) (TAL 1B5), CF488A conjugate, 0.1mg/mL
BNC882187-500 1x 500 µL

HLA-DR (MHC II) (TAL 1B5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details