Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HARS Peptide - N-terminal region

HARS Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20491, HRS, USH3B

UniProt

P12081

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HARS Rabbit Polyclonal Antibody (orb584991) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002100

Preservative

Lyophilized powder

AA Sequence

FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zbtb18 Mouse Gene Knockout Kit (CRISPR)
KN519596 1 Kit

Zbtb18 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PCSK9 activation kit by CRISPRa
GA116832 1 Kit

Human PCSK9 activation kit by CRISPRa

Sign In for Pricing
View Details
SCD1 (SCD) Human Gene Knockout Kit (CRISPR)
KN209148LP 1 Kit

SCD1 (SCD) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
5-Bromopyrimidine
TRC-B686855-25G 25 g

5-Bromopyrimidine

Sign In for Pricing
View Details
Human USF1 activation kit by CRISPRa
GA105094 1 Kit

Human USF1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Asgr2 activation kit by CRISPRa
GA200297 1 Kit

Mouse Asgr2 activation kit by CRISPRa

Sign In for Pricing
View Details