Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HARS Peptide - N-terminal region

HARS Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20491, HRS, USH3B

UniProt

P12081

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HARS Rabbit Polyclonal Antibody (orb584991) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002100

Preservative

Lyophilized powder

AA Sequence

FVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP14 antibody
FNab09310 100 µg

USP14 antibody

Sign In for Pricing
View Details
Ethyl 3-Oxo-3-(2,3,4-trifluorophenyl)propanoate
TRC-E925420-250MG 250 mg

Ethyl 3-Oxo-3-(2,3,4-trifluorophenyl)propanoate

Sign In for Pricing
View Details
Aamdc Mouse Gene Knockout Kit (CRISPR)
KN500583 1 Kit

Aamdc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Oleyl Acetate
TRC-O532990-250MG 250 mg

Oleyl Acetate

Sign In for Pricing
View Details
TIE1 (C-term) Rabbit Polyclonal Antibody
AP31041PU-N 50 µL

TIE1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
α, ω-Bis-Maleimido PEG
112000-45.1G 1 g

α, ω-Bis-Maleimido PEG

Sign In for Pricing
View Details