Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HARS2 Peptide - C-terminal region

HARS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HARSL, HARSR, HO3

UniProt

P49590

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HARS2 Rabbit Polyclonal Antibody (orb326437) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036340

Preservative

Lyophilized powder

AA Sequence

LSIGVERIFYIVEQRMKTKGEKVRTTETQVFVATPQKNFLQERLKLIAEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLB1 Rabbit Polyclonal Antibody (Fluoro550)
orb3098176 100 µg

PLB1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
CYTSB rabbit pAb
RA31911-01 50 µL

CYTSB rabbit pAb

Sign In for Pricing
View Details
CYTSB rabbit pAb
RA31911-02 100 µL

CYTSB rabbit pAb

Sign In for Pricing
View Details
TNFAIP1 antibody
70R-51661 100 µL

TNFAIP1 antibody

Sign In for Pricing
View Details
Monkey Early Growth Response 2 (EGR2) ELISA Kit
abx358912 96 Well

Monkey Early Growth Response 2 (EGR2) ELISA Kit

Sign In for Pricing
View Details
EDC4 Protein Vector (Rat) (pPM-C-HA)
PV265396 500 ng

EDC4 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details