Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAUS1 Peptide - C-terminal region

HAUS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCDC5, FLJ21094, FLJ40084, HEI-C, HsT1461, HEIC

UniProt

Q76N32

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HAUS1 Rabbit Polyclonal Antibody (orb326435) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055962

Preservative

Lyophilized powder

AA Sequence

ELEKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQNMDFLKAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRM1 Antibody
8G205-AAT 50 µg

CHRM1 Antibody

Sign In for Pricing
View Details
Recombinant Rat L-Selectin/CD62L Protein (His Tag)
PDMR100065-01 20 µg

Recombinant Rat L-Selectin/CD62L Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat L-Selectin/CD62L Protein (His Tag)
PDMR100065-02 100 µg

Recombinant Rat L-Selectin/CD62L Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat L-Selectin/CD62L Protein (His Tag)
PDMR100065-03 500 µg

Recombinant Rat L-Selectin/CD62L Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat L-Selectin/CD62L Protein (His Tag)
PDMR100065-04 1 mg

Recombinant Rat L-Selectin/CD62L Protein (His Tag)

Sign In for Pricing
View Details
NMU Rabbit Polyclonal Antibody
TA364286 50 µL

NMU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details