HAUS1 Peptide - C-terminal region
HAUS1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CCDC5, FLJ21094, FLJ40084, HEI-C, HsT1461, HEIC
UniProt
Q76N32
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HAUS1 Rabbit Polyclonal Antibody (orb326435) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055962
Preservative
Lyophilized powder
AA Sequence
ELEKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQNMDFLKAK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882717-500 1x 500 µL
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2717), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
RA-2100-2 2 mL
TRITC Conjugated Goat Polyclonal Antibody to Human IgG
Sign In for Pricing
View Details 
LC401677 20 µg
SSH3BP1 (ABI1) (NM_005470) Human Over-expression Lysate
Sign In for Pricing
View Details 
