Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAX1 Peptide - middle region

HAX1 Peptide - middle region

Product Specifications

Product Name Alternative

HCLSBP1, HS1BP1, SCN3

UniProt

O00165

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HAX1 Rabbit Polyclonal Antibody (orb330666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001018238

Preservative

Lyophilized powder

AA Sequence

QPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abemaciclib Impurity 85
RM-A305085-01 10 mg

Abemaciclib Impurity 85

Sign In for Pricing
View Details
Abemaciclib Impurity 85
RM-A305085-02 25 mg

Abemaciclib Impurity 85

Sign In for Pricing
View Details
Abemaciclib Impurity 85
RM-A305085-03 50 mg

Abemaciclib Impurity 85

Sign In for Pricing
View Details
Abemaciclib Impurity 85
RM-A305085-04 100 mg

Abemaciclib Impurity 85

Sign In for Pricing
View Details
Mark1, CT (Mark1, Emk3, Kiaa1477, Serine/threonine-protein kinase MARK1, ELKL motif serine/threonine-protein kinase 3, MAP/microtubule affinity-regulating kinase 1, PAR1 homolog c) (AP)
MBS6319034-01 0.2 mL

Mark1, CT (Mark1, Emk3, Kiaa1477, Serine/threonine-protein kinase MARK1, ELKL motif serine/threonine-protein kinase 3, MAP/microtubule affinity-regulating kinase 1, PAR1 homolog c) (AP)

Sign In for Pricing
View Details
Mark1, CT (Mark1, Emk3, Kiaa1477, Serine/threonine-protein kinase MARK1, ELKL motif serine/threonine-protein kinase 3, MAP/microtubule affinity-regulating kinase 1, PAR1 homolog c) (AP)
MBS6319034-02 5x 0.2 mL

Mark1, CT (Mark1, Emk3, Kiaa1477, Serine/threonine-protein kinase MARK1, ELKL motif serine/threonine-protein kinase 3, MAP/microtubule affinity-regulating kinase 1, PAR1 homolog c) (AP)

Sign In for Pricing
View Details