Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCCS Peptide - C-terminal region

HCCS Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCHL, DKFZp779I1858, MCOPS7

UniProt

P53701

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HCCS Rabbit Polyclonal Antibody (orb584888) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005324

Preservative

Lyophilized powder

AA Sequence

PRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTTN sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2077506 1.0 µg DNA

RTTN sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
8-Arm PEG-NH2 (MW 40000)
TCL-01574-01 10 mg

8-Arm PEG-NH2 (MW 40000)

Sign In for Pricing
View Details
8-Arm PEG-NH2 (MW 40000)
TCL-01574-02 50 mg

8-Arm PEG-NH2 (MW 40000)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Spore maturation protein A (spmA)
orb2918914-01 20 µg

Recombinant Bacillus subtilis Spore maturation protein A (spmA)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Spore maturation protein A (spmA)
orb2918914-02 100 µg

Recombinant Bacillus subtilis Spore maturation protein A (spmA)

Sign In for Pricing
View Details
ARL6IP4 Human siRNA Oligo Duplex (Locus ID 51329)
SR309716 1 Kit

ARL6IP4 Human siRNA Oligo Duplex (Locus ID 51329)

Sign In for Pricing
View Details