Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCCS Peptide - N-terminal region

HCCS Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCHL, DKFZp779I1858, MCOPS7

UniProt

P53701

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HCCS Rabbit Polyclonal Antibody (orb584889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005324

Preservative

Lyophilized powder

AA Sequence

PAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Pro-Amylin ELISA Kit
MBS036292 Inquire

Rabbit Pro-Amylin ELISA Kit

Sign In for Pricing
View Details
Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 23.6 kDa protein in LEF2-PH intergenic region
MBS1168688-01 0.02 mg (E-Coli)

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 23.6 kDa protein in LEF2-PH intergenic region

Sign In for Pricing
View Details
Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 23.6 kDa protein in LEF2-PH intergenic region
MBS1168688-02 0.1 mg (E-Coli)

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 23.6 kDa protein in LEF2-PH intergenic region

Sign In for Pricing
View Details
Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 23.6 kDa protein in LEF2-PH intergenic region
MBS1168688-03 0.02 mg (Yeast)

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 23.6 kDa protein in LEF2-PH intergenic region

Sign In for Pricing
View Details
Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 23.6 kDa protein in LEF2-PH intergenic region
MBS1168688-04 0.1 mg (Yeast)

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 23.6 kDa protein in LEF2-PH intergenic region

Sign In for Pricing
View Details
Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 23.6 kDa protein in LEF2-PH intergenic region
MBS1168688-05 0.02 mg (Baculovirus)

Recombinant Autographa californica nuclear polyhedrosis virus Uncharacterized 23.6 kDa protein in LEF2-PH intergenic region

Sign In for Pricing
View Details