Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hdac3 Peptide - C-terminal region

Hdac3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Hdac3

UniProt

Q6P6W3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hdac3 Rabbit Polyclonal Antibody (orb578599) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_445900

Preservative

Lyophilized powder

AA Sequence

DVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAC17 CRISPRa sgRNA lentivector (set of three targets)(Human)
68572121 3x 1.0µg DNA

TRNAC17 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
YMEL1, NT (YME1L1, FTSH1, YME1L, ATP-dependent zinc metalloprotease YME1L1, ATP-dependent metalloprotease FtsH1, Meg-4, Presenilin-associated metalloprotease, YME1-like protein 1) (PE) discontinued
043961-PE 200 µL

YMEL1, NT (YME1L1, FTSH1, YME1L, ATP-dependent zinc metalloprotease YME1L1, ATP-dependent metalloprotease FtsH1, Meg-4, Presenilin-associated metalloprotease, YME1-like protein 1) (PE) discontinued

Sign In for Pricing
View Details
HOXA3 Rabbit pAb
E47R11292 100 µL

HOXA3 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Impdh1 shRNA (UAS) - Lentiviral mouse Impdh1 shRNA (UAS, iRFP) plasmid
GTR15143428 1 Vial

Lentiviral mouse Impdh1 shRNA (UAS) - Lentiviral mouse Impdh1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
PDCD1LG2 Antibody - middle region
ARP80891_P050-25UL 25 µL

PDCD1LG2 Antibody - middle region

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Serine/Arginine Rich Splicing Factor 2 (SRSF2)
MBS2075968-01 0.1 mL

PE-Linked Polyclonal Antibody to Serine/Arginine Rich Splicing Factor 2 (SRSF2)

Sign In for Pricing
View Details