Hdac6 Peptide - N-terminal region
Hdac6 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Hdac6
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Hdac6 Rabbit Polyclonal Antibody (orb574130) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
IHC, WB
NCBI Accession Number
XP_228753
Preservative
Lyophilized powder
AA Sequence
RQRKSRHNPQSPLQDSSATLKRGGKKGAVPHSSPNLAEVKKKGKMKKLSQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942007-500 1x 500 µL
MHC II, Mouse (MK-D6), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![FSIP1 Mouse Monoclonal Antibody [Clone ID: OTI6F6]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907e4e/imageurl/cf806088.webp)
BNC681484-100 1x 100 µL
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-D233040-1G 1 g
Dehydrodivanillin (~90%, contains up to 10% unknown inorganics)
Sign In for Pricing
View Details