Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hdac6 Peptide - N-terminal region

Hdac6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hdac6

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hdac6 Rabbit Polyclonal Antibody (orb574130) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

XP_228753

Preservative

Lyophilized powder

AA Sequence

RQRKSRHNPQSPLQDSSATLKRGGKKGAVPHSSPNLAEVKKKGKMKKLSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICOS Rabbit Polyclonal Antibody
TA368824 100 µL

ICOS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Quinoxalinecarboxylic Acid
TRC-Q765265-500MG 500 mg

2-Quinoxalinecarboxylic Acid

Sign In for Pricing
View Details
DEFB126 (NM_030931) Human Over-expression Lysate
LY403096 100 µg

DEFB126 (NM_030931) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS804315 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/1623), CF568 conjugate, 0.1mg/mL
BNC683804-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/1623), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HABP2 (NM_004132) Human Over-expression Lysate
LY401333 100 µg

HABP2 (NM_004132) Human Over-expression Lysate

Sign In for Pricing
View Details