Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEMGN Peptide - N-terminal region

HEMGN Peptide - N-terminal region

Product Specifications

Product Name Alternative

EDAG, EDAG-1

UniProt

Q9BXL5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HEMGN Rabbit Polyclonal Antibody (orb583717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_932095

Preservative

Lyophilized powder

AA Sequence

MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5HT3A receptor (HTR3A) (N-term) Rabbit Polyclonal Antibody
AP52128PU-N 400 µL

5HT3A receptor (HTR3A) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ankrd34a Mouse Gene Knockout Kit (CRISPR)
KN501283 1 Kit

Ankrd34a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P75 NGF Receptor Recombinant Chimeric Antibody Antibody
HA723532 100 µL

P75 NGF Receptor Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
ReadiLink™ Rapid Cy5 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*
1292-AAT 2 Labelings

ReadiLink™ Rapid Cy5 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*

Sign In for Pricing
View Details
PRELP (NM_201348) Human Recombinant Protein
TP307609L 1 mg

PRELP (NM_201348) Human Recombinant Protein

Sign In for Pricing
View Details
RBMS1 (NM_016836) Human Recombinant Protein
TP760059 50 µg

RBMS1 (NM_016836) Human Recombinant Protein

Sign In for Pricing
View Details