Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEMGN Peptide - N-terminal region

HEMGN Peptide - N-terminal region

Product Specifications

Product Name Alternative

EDAG, EDAG-1

UniProt

Q9BXL5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HEMGN Rabbit Polyclonal Antibody (orb583717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_932095

Preservative

Lyophilized powder

AA Sequence

MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-O-α-D-Mannopyranosyl D-Mannose
TRC-M166340-5MG 5 mg

3-O-α-D-Mannopyranosyl D-Mannose

Sign In for Pricing
View Details
L1CAM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H4]
TA501453BM 100 µL

L1CAM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H4]

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/903), CF640R conjugate, 0.1mg/mL
BNC400903-100 1x 100 µL

Cytokeratin 7 (KRT7/903), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GnRH (GNRH1) (NM_001083111) Human Recombinant Protein
TP319734L 1 mg

GnRH (GNRH1) (NM_001083111) Human Recombinant Protein

Sign In for Pricing
View Details
HSD11B1L (NM_001267868) Human Tagged ORF Clone
RG237516 10 µg

HSD11B1L (NM_001267868) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Human IgG3 Antibody (HRP)
KH-2883-01 50 μL

Anti-Human IgG3 Antibody (HRP)

Sign In for Pricing
View Details