HERC4 Peptide - middle region
HERC4 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp564G092, KIAA1593
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HERC4 Rabbit Polyclonal Antibody (orb578675) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001017972
Preservative
Lyophilized powder
AA Sequence
VGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEILKVCQISRLYR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
F6024-02 50 mg
Forskolin (7b-Acetoxy-8,13-epoxy-1a,6b,9a-trihydroxy- labd-14-ene-11-one, Coleonol, Colforsin)
Sign In for Pricing
View Details