Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HERC6 Peptide - N-terminal region

HERC6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20637

UniProt

Q8IVU3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HERC6 Rabbit Polyclonal Antibody (orb578763) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060382

Preservative

Lyophilized powder

AA Sequence

LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (Nuclear Marker) (HH1/1784R), 0.2mg/mL
BNUB1784-500 1x 500 µL

Histone H1 (Nuclear Marker) (HH1/1784R), 0.2mg/mL

Sign In for Pricing
View Details
Kyat3 Mouse Gene Knockout Kit (CRISPR)
KN502625 1 Kit

Kyat3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DUSP6 Rabbit Monoclonal Antibody
TA422450 100 µL

DUSP6 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MIR99AHG (NM_001005732) Human Over-expression Lysate
LC423635 20 µg

MIR99AHG (NM_001005732) Human Over-expression Lysate

Sign In for Pricing
View Details
Mix-n-StainTM CF®710 Antibody Labeling Kit, 1x (20-50ug) labeling
#92580 1 Kit

Mix-n-StainTM CF®710 Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
EGFR Mouse Monoclonal Antibody [Clone ID: GFR450]
AM32821PU-T 20 µg

EGFR Mouse Monoclonal Antibody [Clone ID: GFR450]

Sign In for Pricing
View Details