Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hes1 Peptide - C-terminal region

Hes1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Hes1

UniProt

Q04666

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hes1 Rabbit Polyclonal Antibody (orb573989) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077336

Preservative

Lyophilized powder

AA Sequence

AFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTADSMWRPWR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF594 conjugate, 0.1mg/mL
BNC942900-100 1x 100 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: SPM565]
AM50149PU-S 100 µg

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: SPM565]

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS800487 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
PREPL Antibody
KC-31417-01 50 μL

PREPL Antibody

Sign In for Pricing
View Details
PREPL Antibody
KC-31417-02 100 µL

PREPL Antibody

Sign In for Pricing
View Details
PREPL Antibody
KC-31417-03 1 mL

PREPL Antibody

Sign In for Pricing
View Details