Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hes1 Peptide - C-terminal region

Hes1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Hes1

UniProt

Q04666

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hes1 Rabbit Polyclonal Antibody (orb573989) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077336

Preservative

Lyophilized powder

AA Sequence

AFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTADSMWRPWR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11ORF77 (HARBI1) (N-term) Rabbit Polyclonal Antibody
AP52001PU-N 400 µL

C11ORF77 (HARBI1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), 1mg/mL
BNUM2453-50 1x 50 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2453), 1mg/mL

Sign In for Pricing
View Details
BSPRY Human Gene Knockout Kit (CRISPR)
KN418642 1 Kit

BSPRY Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STAG3 Human Gene Knockout Kit (CRISPR)
KN418189 1 Kit

STAG3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CDK7 Antibody
8C0353-AAT 50 µg

CDK7 Antibody

Sign In for Pricing
View Details
Mix-n-StainTM CF®660R Antibody Labeling Kit, 1x (20-50ug) labeling
#92261 1 Kit

Mix-n-StainTM CF®660R Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details