Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HES5 Peptide - middle region

HES5 Peptide - middle region

Product Specifications

Product Name Alternative

BHLHb38

UniProt

Q5TA89

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HES5 Rabbit Polyclonal Antibody (orb581071) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010926

Preservative

Lyophilized powder

AA Sequence

AASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCF, murine recombinant
4328-1000 1 mg

SCF, murine recombinant

Sign In for Pricing
View Details
Cd200r1 (NM_021325) Mouse Tagged ORF Clone
MR204778 10 µg

Cd200r1 (NM_021325) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human PRB1 ELISA Kit
orb564460-01 48 Tests

Human PRB1 ELISA Kit

Sign In for Pricing
View Details
Human PRB1 ELISA Kit
orb564460-02 96 Tests

Human PRB1 ELISA Kit

Sign In for Pricing
View Details
GZMK Antibody - N-terminal region : HRP (ARP45219_P050-HRP)
ARP45219_P050-HRP 100 µL

GZMK Antibody - N-terminal region : HRP (ARP45219_P050-HRP)

Sign In for Pricing
View Details
DNA repair protein complementing XP-A cells (XPA) Human ELISA Kit
C9425 96 Tests

DNA repair protein complementing XP-A cells (XPA) Human ELISA Kit

Sign In for Pricing
View Details