Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HES5 Peptide - middle region

HES5 Peptide - middle region

Product Specifications

Product Name Alternative

BHLHb38

UniProt

Q5TA89

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HES5 Rabbit Polyclonal Antibody (orb581071) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010926

Preservative

Lyophilized powder

AA Sequence

AASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGHD6-13 sgRNA CRISPR Lentivector (Human) (Target 3)
K1030504 1.0 µg DNA

IGHD6-13 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
GPS1 (Center) Rabbit pAb
MBS8551792-01 0.1 mL

GPS1 (Center) Rabbit pAb

Sign In for Pricing
View Details
GPS1 (Center) Rabbit pAb
MBS8551792-02 0.1 mL (AF405L)

GPS1 (Center) Rabbit pAb

Sign In for Pricing
View Details
GPS1 (Center) Rabbit pAb
MBS8551792-03 0.1 mL (AF405S)

GPS1 (Center) Rabbit pAb

Sign In for Pricing
View Details
GPS1 (Center) Rabbit pAb
MBS8551792-04 0.1 mL (AF610)

GPS1 (Center) Rabbit pAb

Sign In for Pricing
View Details
GPS1 (Center) Rabbit pAb
MBS8551792-05 0.1 mL (AF635)

GPS1 (Center) Rabbit pAb

Sign In for Pricing
View Details