Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HFE Peptide - N-terminal region

HFE Peptide - N-terminal region

Product Specifications

Product Name Alternative

HFE1, HH, HLA-H, MGC103790, dJ221C16.10.1, MVCD7, TFQTL2

UniProt

Q30201

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HFE Rabbit Polyclonal Antibody (orb579117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000401

Preservative

Lyophilized powder

AA Sequence

MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARC2 Protein Vector (Human) (pPB-N-His)
PV093263 500 ng

MARC2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
FGF21 Recombinant Protein
OPCD03198-10UG 10 µg

FGF21 Recombinant Protein

Sign In for Pricing
View Details
CSF2 (Colony Stimulating Factor 2 (Granulocyte-Macrophage), GMCSF, MGC131935, MGC138897) (MaxLight 550)
244998-ML550 100 µL

CSF2 (Colony Stimulating Factor 2 (Granulocyte-Macrophage), GMCSF, MGC131935, MGC138897) (MaxLight 550)

Sign In for Pricing
View Details
KT-362 fumarate
orb1700215-01 1 mg

KT-362 fumarate

Sign In for Pricing
View Details
KT-362 fumarate
orb1700215-02 5 mg

KT-362 fumarate

Sign In for Pricing
View Details
KT-362 fumarate
orb1700215-03 1 ml x 10 mM (in DMSO)

KT-362 fumarate

Sign In for Pricing
View Details